PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_711044AD5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 314aa    MW: 34791.9 Da    PI: 6.79
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_711044AD5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rgrWT+ Ed+ l+++++++G g+W++ ++  g+ R++k+c++rw +yl
  Traes_1DS_711044AD5.1 14 RGRWTAKEDDTLAKYIARHGEGSWRSLPQNAGLLRCGKSCRLRWVNYL 61
                           8*******************************99************97 PP

2Myb_DNA-binding57.14.3e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+++ eEd+l+v++++ lG++ W++Ia++++ gRt++++k++w+ +
  Traes_1DS_711044AD5.1  67 RGNFSNEEDDLIVKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNAH 111
                            89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.859961IPR017930Myb domain
SuperFamilySSF466898.99E-2911108IPR009057Homeodomain-like
SMARTSM007178.0E-111363IPR001005SANT/Myb domain
PfamPF002494.3E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-201568IPR009057Homeodomain-like
CDDcd001675.38E-91661No hitNo description
PROSITE profilePS5129425.13262116IPR017930Myb domain
SMARTSM007171.4E-1766114IPR001005SANT/Myb domain
PfamPF002491.7E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2569115IPR009057Homeodomain-like
CDDcd001671.63E-1369112No hitNo description
PfamPF066405.4E-4130169IPR010588Myb-related protein P, C-terminal
PfamPF066402.1E-21186314IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAK EDDTLAKYIA RHGEGSWRSL PQNAGLLRCG KSCRLRWVNY  60
LRDGVRRGNF SNEEDDLIVK LHATLGNRWS LIASHLPGRT DNEIKNYWNA HLSRRSHSFR  120
HTHTAGKETT ITIDINKISA TSKRRGGRAP RSSMKKQPVP EPTKSTESSS PVPAISSSTS  180
SLPQGYSDKN QPINSIPNDM PCSDHVDLNG GVLKPNYAKD SMNQIGILEE ESEIEGLLSS  240
MDDMPASGLN GLQHGGHLPL VEDLLDMDWE GFATHLWDQP AQSDQLQPAE PQATMGSVSD  300
ELESFVHWLL SDTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-22121155107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558096.11e-142PREDICTED: myb-related protein P-like
TrEMBLW5ALN80.0W5ALN8_WHEAT; Uncharacterized protein
STRINGBRADI1G64687.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-70myb domain protein 12
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]